| Edit |   |
|---|
| Antigenic Specificity | PIGR |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-PIGR Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human PIGR (579-613aa DAAPDEKVLDSGFREIENKAIQDPRLFAEEKAVAD), different from the related rat sequence by eighteen amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | polymeric immunoglobulin receptor; Polymeric immunoglobulin receptor; polymeric immunoglobulin receptor; polymeric immunoglobulin receptor; Hepatocellular carcinoma-associated protein TB6, PIGR; PIGR; PIgR; Poly-Ig receptor |
|---|
| Gene, Accession # | PIGR, Gene ID: 5284, NCBI: NP_002635.2, UniProt: P01833 |
|---|
| Catalog # | MBS178150 |
|---|
| Price | |
|---|
| Order / More Info | PIGR Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: PIGR polymeric immunoglobulin receptor. 2. Hood L, Kronenberg M, Hunkapiller T (Feb 1985). T cell antigen receptors and the immunoglobulin supergene family. Cell 40 (2): 225-9. 3. Kaetzel CS (Aug 2005). The polymeric immunoglobulin receptor: bridging innate and adaptive immune responses at mucosal surfaces. Immunological Reviews 206: 83-99. |
|---|