| Edit |   |
|---|
| Antigenic Specificity | Peptide tyrosine tyrosine |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | n/a |
|---|
| Isotype | n/a |
|---|
| Format | serum |
|---|
| Size | 0.1 mL |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry (IHC), Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Peptide tyrosine tyrosine polyclonal antibody. Recognizes PYY in a wide range of species. |
|---|
| Immunogen | Natural pig PYY (peptide with tyrosine; HYPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2.). |
|---|
| Other Names | Peptide YY; Peptide YY; peptide YY; PYY-II, PYY; PYY; PYY |
|---|
| Gene, Accession # | Gene ID: 100512433, NCBI: P68005.1, UniProt: P68005 |
|---|
| Catalog # | MBS565786 |
|---|
| Price | |
|---|
| Order / More Info | Peptide tyrosine tyrosine Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|