| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ING1 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-ING1 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human ING1 (192-223aa KELDECYERFSRETDGAQKRRMLHCVQRALIR), different from the related mouse sequence by seven amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | inhibitor of growth protein 1 isoform E; Inhibitor of growth protein 1; inhibitor of growth protein 1; inhibitor of growth family member 1, ING1; ING1; p33; p47; p33ING1; p24ING1c; p33ING1b; p47ING1a |
|---|
| Gene, Accession # | ING1, Gene ID: 3621, NCBI: NP_001254657.1, UniProt: Q9UK53 |
|---|
| Catalog # | MBS178236 |
|---|
| Price | |
|---|
| Order / More Info | ING1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: ING1 inhibitor of growth family, member 1. 2. Garkavtsev I, Kazarov A, Gudkov A, Riabowol K (Jan 1997). Suppression of the novel growth inhibitor p33ING1 promotes neoplastic transformation. Nat Genet 14 (4): 415-20. 3. Garkavtsev I, Demetrick D, Riabowol K (Jul 1997). Cellular localization and chromosome mapping of a novel candidate tumor suppressor gene (ING1). Cytogenet Cell Genet 76 (3-4): 176-8. |
|---|
| 产品资料 |
|
|