| Edit |   |
|---|
| Antigenic Specificity | AC |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | Drosophila |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | AC antibody. Specificity: AC antibody was raised against the N terminal Of Ac |
|---|
| Immunogen | AC antibody was raised using the N terminal Of Ac corresponding to a region with amino acids FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGA |
|---|
| Other Names | AC; AC; Hw; ascT5; 990 E5 F1; CG3796; T5; AS-C T5ac; EG:125H10.3; ASC; sc/T5; AS-C T5, |
|---|
| Gene, Accession # | AC |
|---|
| Catalog # | MBS5301908 |
|---|
| Price | |
|---|
| Order / More Info | AC Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|