| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ACADVL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-ACADVL Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human ACADVL (538-576aa RALEQFATVVEAKLIKHKKGIVNEQFLLQRLADGAIDLY), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids. |
|---|
| Other Names | very long-chain specific acyl-CoA dehydrogenase, mitochondrial isoform 1; Very long-chain specific acyl-CoA dehydrogenase, mitochondrial; very long-chain specific acyl-CoA dehydrogenase, mitochondrial; acyl-CoA dehydrogenase, very long chain, ACADVL; ACADVL; ACAD6; LCACD; VLCAD; VLCAD; VLCAD |
|---|
| Gene, Accession # | ACADVL, Gene ID: 37, NCBI: NP_000009.1, UniProt: P49748 |
|---|
| Catalog # | MBS178779 |
|---|
| Price | |
|---|
| Order / More Info | ACADVL Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Andresen BS, Olpin S, Poorthuis BJ, Scholte HR, Vianey-Saban C, Wanders R, Ijlst L, Morris A, Pourfarzam M, Bartlett K, Baumgartner ER, deKlerk JB, Schroeder LD, Corydon TJ, Lund H, Winter V, Bross P, Bolund L, Gregersen N (Feb 1999). Clear correlation of genotype with disease phenotype in very-long-chain acyl-CoA dehydrogenase deficiency. American Journal of Human Genetics 64 (2): 479-94. 2. Strauss AW, Powell CK, Hale DE, Anderson MM, Ahuja A, Brackett JC, Sims HF (Nov 1995). Molecula |
|---|
| 产品资料 |
|
|