| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Cardiac FABP |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | mouse, rat predicted to work with: human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-Cardiac FABP Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Cardiac FABP (15-48aa KNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGD), identical to the related mouse and rat sequences.Ig Type: Rabbit IgG |
|---|
| Other Names | fatty acid-binding protein, heart isoform 2; Fatty acid-binding protein, heart; fatty acid-binding protein, heart; fatty acid binding protein 3; Fatty acid-binding protein 3; Heart-type fatty acid-binding protein; H-FABP; Mammary-derived growth inhibitor; MDGI; Muscle fatty acid-binding protein; M-FABP, FABP3; FABP3; MDGI; FABP11; H-FABP; M-FABP; O-FABP; FABP11; MDGI; H-FABP; MDGI; M-FABP |
|---|
| Gene, Accession # | Gene ID: 2170, NCBI: NP_004093.1, UniProt: P05413 |
|---|
| Catalog # | MBS177940 |
|---|
| Price | |
|---|
| Order / More Info | Cardiac FABP Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: FABP3 fatty acid binding protein 3, muscle and heart (mammary-derived growthinhibitor). 2. Borchers, T., Hojrup, P., Nielsen, S. U., Roepstorff, P., Spener, F., Knudsen, J. Revision of the amino acid sequence of human heart fatty acid binding protein. Molec. Cell. Biochem. 98: 127-133, 1990. 3. Phelan CM, Larsson C, Baird S, Futreal PA, Ruttledge MH, Morgan K, Tonin P, Hung H, Korneluk RG, Pollak MN, Narod SA (Dec 1996). The human mammary-derived growth inhibitor (MDGI) gene: |
|---|
| 产品资料 |
|
|