| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MUC3A/MUC3B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-MUC3 Antibody. Reactivity: Human No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human MUC3 (DLNDNTSQAYRDFNKTFWNQMQKIFADMQGFTFK). |
|---|
| Other Names | mucin-3A; Mucin-3A; mucin-3A; mucin 3A, cell surface associated; Intestinal mucin-3A, MUC3A; MUC3A; MUC3; MUC-3A; MUC-3ACurated |
|---|
| Gene, Accession # | MUC3A/MUC3B, Gene ID: 4584, NCBI: NP_005951.1, UniProt: Q02505 |
|---|
| Catalog # | MBS178455 |
|---|
| Price | |
|---|
| Order / More Info | MUC3A/MUC3B Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Fox, M., Lahbib, F., Pratt, W., Attwood, J., Gum, J., Kim, Y., Swallow, D. M. Regional localisation of MUC3 to chromosome 7q22. (Abstract) Cytogenet. Cell Genet. 58: 1920-1921, 1991. 2. Pan, Q., Tian, Y., Li, X., Ye, J., Liu, Y., Song, L., Yang, Y., Zhu, R., He, Y., Chen, L., Chen, W., Mao, X., Peng, Z., Wang, R. Enhanced membrane-tethered mucin 3 (MUC3) expression by a tetrameric branched peptide with a conserved TFLK motif inhibits bacteria adherence. J. Biol. Chem. 288: 5407-5416, 2013. |
|---|
| 产品资料 |
|
|