| Edit |   |
|---|
| Antigenic Specificity | GMF gamma |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | GMF gamma antibody. Specificity: GMF gamma antibody was raised against the middle region of GMFG |
|---|
| Immunogen | GMF gamma antibody was raised using the middle region of GMFG corresponding to a region with amino acids KVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSY |
|---|
| Other Names | GMF gamma; GMF gamma; MGC126867; Glia Maturation Factor Gamma; GMF-GAMMA; GMFG, |
|---|
| Gene, Accession # | GMF gamma |
|---|
| Catalog # | MBS5302229 |
|---|
| Price | |
|---|
| Order / More Info | GMF gamma Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|