| Edit |   |
|---|
| Antigenic Specificity | SUSD3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SUSD3 antibody. Specificity: SUSD3 antibody was raised against the N terminal of SUSD3 |
|---|
| Immunogen | SUSD3 antibody was raised using the N terminal of SUSD3 corresponding to a region with amino acids LRLPPQATFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEW |
|---|
| Other Names | sushi domain-containing protein 3 isoform d; Sushi domain-containing protein 3; sushi domain-containing protein 3; sushi domain containing 3, SUSD3; SUSD3 |
|---|
| Gene, Accession # | SUSD3, Gene ID: 203328, NCBI: NP_001273936.1 |
|---|
| Catalog # | MBS5302728 |
|---|
| Price | |
|---|
| Order / More Info | SUSD3 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|