| Edit |   |
|---|
| Antigenic Specificity | Chymotrypsin-Like |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Chymotrypsin-Like antibody. Specificity: Chymotrypsin-Like antibody was raised against the N terminal of CTRL |
|---|
| Immunogen | Chymotrypsin-Like antibody was raised using the N terminal of CTRL corresponding to a region with amino acids SQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNS |
|---|
| Other Names | Chymotrypsin-Like; Chymotrypsin-Like; CTRL; CTRL1; MGC70821, |
|---|
| Gene, Accession # | n/a |
|---|
| Catalog # | MBS839240 |
|---|
| Price | |
|---|
| Order / More Info | Chymotrypsin-Like Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|