| Edit |   |
|---|
| Antigenic Specificity | TSLP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-TSLP Picoband Antibody. Reactivity: Mouse, Rat No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence of mouse TSLP (QEMAQEVQNICLNQTSQILRLWYSFMQSPE). |
|---|
| Other Names | thymic stromal lymphopoietin; Thymic stromal lymphopoietin; thymic stromal lymphopoietin; thymic stromal lymphopoietin; Thymic stroma-derived lymphopoietin, Tslp; Tslp |
|---|
| Gene, Accession # | TSLP, Gene ID: 53603, NCBI: NP_067342.1, UniProt: Q9JIE6 |
|---|
| Catalog # | MBS1750567 |
|---|
| Price | |
|---|
| Order / More Info | TSLP Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|