| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CPT1B |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-CPT1B Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human CPT1B (197-226aa DDEEYYRMELLAKEFQDKTAPRLQKYLVLK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | carnitine O-palmitoyltransferase 1, muscle isoform isoform c; Carnitine O-palmitoyltransferase 1, muscle isoform; carnitine O-palmitoyltransferase 1, muscle isoform; carnitine palmitoyltransferase 1B; Carnitine O-palmitoyltransferase I, muscle isoform; CPT I; CPTI-M; Carnitine palmitoyltransferase 1B; Carnitine palmitoyltransferase I-like protein, CPT1B; CPT1B; CPTI; CPT1M; MCPT1; CPT1-M; CPTI-M; M-CPT1; MCCPT1; KIAA1670; CPT1-M; CPT I; CPTI-M |
|---|
| Gene, Accession # | CPT1B, Gene ID: 1375, NCBI: NP_001138606.1, UniProt: Q92523 |
|---|
| Catalog # | MBS177685 |
|---|
| Price | |
|---|
| Order / More Info | CPT1B Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Auinger A; Rubin D; Sabandal M; Helwig U; Ruther A; Schreiber S; Foelsch UR; Doring F; Schrezenmeir J. A common haplotype of carnitine palmitoyltransferase 1b is associated with the metabolic syndrome. Br J Nutr, 2013 Mar 14. |
|---|
| 产品资料 |
|
|