| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | 5HT2A Receptor |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-5HT2A Receptor Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | 5-hydroxytryptamine receptor 2A isoform 1; 5-hydroxytryptamine receptor 2A; 5-hydroxytryptamine receptor 2A; 5-hydroxytryptamine receptor 2A; Serotonin receptor 2A, HTR2A; HTR2A; HTR2; 5-HT2A; HTR2; 5-HT-2; 5-HT-2A |
|---|
| Gene, Accession # | Gene ID: 3356, NCBI: NP_000612.1, UniProt: P28223 |
|---|
| Catalog # | MBS178183 |
|---|
| Price | |
|---|
| Order / More Info | 5HT2A Receptor Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Cook EH, Fletcher KE, Wainwright M, Marks N, Yan SY, Leventhal BL (August 1994). Primary structure of the human platelet serotonin 5-HT2 receptor: identity with frontal cortex serotonin 5-HT2A receptor. J. Neurochem. 63 (2): 465-9. 2. Elphick GF, Querbes W, Jordan JA, Gee GV, Eash S, Manley K, Dugan A, Stanifer M, Bhatnagar A, Kroeze WK, Roth BL, Atwood WJ (2004). The human polyomavirus, JCV, uses serotonin receptors to infect cells. Science 306 (5700): 1380-3. |
|---|
| 产品资料 |
|
|