| Edit |   |
|---|
| Antigenic Specificity | 5HT3A receptor |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-5HT3A receptor Picoband Antibody. Reactivity: Human, Mouse, Rat No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human 5HT3A receptor (72-108aa NVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITK L), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino aciSubcellular Localization: Cell junction, syn |
|---|
| Other Names | 5-hydroxytryptamine receptor 3A isoform b; 5-hydroxytryptamine receptor 3A; 5-hydroxytryptamine receptor 3A; 5-hydroxytryptamine receptor 3A; 5-hydroxytryptamine receptor 3; 5-HT-3; 5-HT3R; Serotonin receptor 3A; Serotonin-gated ion channel receptor, HTR3A; HTR3A; HTR3; 5HT3R; 5-HT-3; 5-HT3A; 5-HT3R; 5HT3R; HTR3; 5-HT3-A; 5-HT3A; 5-HT-3; 5-HT3R |
|---|
| Gene, Accession # | HTR3A, Gene ID: 3359, NCBI: NP_000860.2, UniProt: P46098 |
|---|
| Catalog # | MBS1750764 |
|---|
| Price | |
|---|
| Order / More Info | 5HT3A receptor Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|