| Edit |   |
|---|
| Antigenic Specificity | PNPLA5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | PNPLA5 antibody. Specificity: PNPLA5 antibody was raised against the N terminal of PNPLA5 |
|---|
| Immunogen | PNPLA5 antibody was raised using the N terminal of PNPLA5 corresponding to a region with amino acids LSLSILHPAYAPIEHVKQQLQDALPPDAHVLASQRLGISLTRWPDGRNFL |
|---|
| Other Names | PNPLA5; PNPLA5; PNPLA5; dJ388M5; PNPLA 5; 4833426H19Rik; Patatin-Like Phospholipase Domain Containing 5; PNPLA-5; GS2L; dJ388M5.4, |
|---|
| Gene, Accession # | PNPLA5 |
|---|
| Catalog # | MBS839527 |
|---|
| Price | |
|---|
| Order / More Info | PNPLA5 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|