| Edit |   |
|---|
| Antigenic Specificity | LAB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | Drosophila |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | LAB antibody. Specificity: LAB antibody was raised against the N terminal Of Lab |
|---|
| Immunogen | LAB antibody was raised using the N terminal Of Lab corresponding to a region with amino acids MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL |
|---|
| Other Names | LAB; LAB; l(3)01241; BG:DS00004.9; lb; EfR9; F24; F121; l(3)84Ac; DmLab; F90-2; CG1264; F90; Dmel_CG1264, |
|---|
| Gene, Accession # | LAB |
|---|
| Catalog # | MBS5302225 |
|---|
| Price | |
|---|
| Order / More Info | LAB Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|