| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EBP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-EBP1 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human EBP1 (138-178aa RKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN), identical to the related mouse and rat sequences. |
|---|
| Other Names | proliferation-associated protein 2G4; Proliferation-associated protein 2G4; proliferation-associated protein 2G4; proliferation-associated 2G4; Cell cycle protein p38-2G4 homolog; hG4-1; ErbB3-binding protein 1, PA2G4; PA2G4; EBP1; HG4-1; p38-2G4; EBP1; hG4-1 |
|---|
| Gene, Accession # | PA2G4, Gene ID: 5036, NCBI: NP_006182.2, UniProt: Q9UQ80 |
|---|
| Catalog # | MBS178670 |
|---|
| Price | |
|---|
| Order / More Info | EBP1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Lamartine J, Seri M, Cinti R, Heitzmann F, Creaven M, Radomski N, Jost E, Lenoir GM, Romeo G, Sylla BS (November 1997). Molecular cloning and mapping of a human cDNA (PA2G4) that encodes a protein highly homologous to the mouse cell cycle protein p38-2G4. Cytogenet Cell Genet. 78 (1): 31-5. 2. Entrez Gene: PA2G4 proliferation-associated 2G4, 38kDa. |
|---|
| 产品资料 |
|
|