| Edit |   |
|---|
| Antigenic Specificity | LOC116349 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | LOC116349 antibody. Specificity: LOC116349 antibody was raised against the N terminal of LOC116349 |
|---|
| Immunogen | LOC116349 antibody was raised using the N terminal of LOC116349 corresponding to a region with amino acids PAVFMLASSSALQCGRGVPRFPRTEVGAGHSVNEETKAEKVGNQTSVIPA |
|---|
| Other Names | LOC116349 protein, partial; Uncharacterized protein EXOC3-AS1; EXOC3 antisense RNA 1; EXOC3 antisense RNA 1Curated; EXOC3 antisense gene protein 1Curated, EXOC3-AS1; EXOC3-AS1; C5orf55 |
|---|
| Gene, Accession # | LOC116349, Gene ID: 116349, NCBI: AAH14011.2 |
|---|
| Catalog # | MBS5302325 |
|---|
| Price | |
|---|
| Order / More Info | LOC116349 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|