| Edit |   |
|---|
| Antigenic Specificity | LOC152586 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | LOC152586 antibody. Specificity: LOC152586 antibody was raised against the middle region of LOC152586 |
|---|
| Immunogen | LOC152586 antibody was raised using the middle region of LOC152586 corresponding to a region with amino acids KPIDWLLNDIFQVKVCDAGEDLRNCMKRKKQIRIQYKPSLFQHVGIHSSF |
|---|
| Other Names | LOC152586; LOC152586; LOC 152586; Glycosyltransferase 54 Domain-Containing Protein; LOC-152586; MGC43429; LOC152586, |
|---|
| Gene, Accession # | LOC152586 |
|---|
| Catalog # | MBS5302863 |
|---|
| Price | |
|---|
| Order / More Info | LOC152586 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|