| Edit |   |
| Antigenic Specificity | LOC161247 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 0.05 mg |
| Concentration | 1 mg/ml |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | LOC161247 antibody. Specificity: LOC161247 antibody was raised against the middle region of Loc161247 |
| Immunogen | LOC161247 antibody was raised using the middle region of Loc161247 corresponding to a region with amino acids YFHQYTHKVVGAAVGTFAWYLTYGSWYHQPWSPGSPGHGLFPRPHSSRKH |
| Other Names | LOC161247; LOC161247; LOC 161247; LOC-161247; LOC161247; MGC46490, |
| Gene, Accession # | LOC161247 |
| Catalog # | MBS838929 |
| Price | |
| Order / More Info | LOC161247 Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |