| Edit |   |
|---|
| Antigenic Specificity | NKG2D |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse, rat predicted human |
|---|
| Isotype | n/a |
|---|
| Format | n/a |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-NKG2D Picoband antibody. Reactivity: Mouse, Rat Predicted Reactivity: Human No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence of human NKG2D (YQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYH).Subcellular Localization: Cell membrane.Tissue Specificity: Expressed in natural killer (NK) cells, CD8( ) alpha-beta and gamma-delta T-cells. Expressed on essentially all CD56 CD3- NK cell |
|---|
| Other Names | NKG2-D type II integral membrane protein; NKG2-D type II integral membrane protein; NKG2-D type II integral membrane protein; KLRC4-KLRK1 readthrough; Killer cell lectin-like receptor subfamily K member 1; NK cell receptor D; NKG2-D-activating NK receptor; CD_antigen: CD314, KLRC4-KLRK1; KLRK1; D12S2489E; NKG2D |
|---|
| Gene, Accession # | NKG2D, Gene ID: 100528032, NCBI: NP_001186734.1, UniProt: P26718 |
|---|
| Catalog # | MBS1750460 |
|---|
| Price | |
|---|
| Order / More Info | NKG2D Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|