| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DDAH1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-DDAH1 Antibody. Reactivity: Human, Mouse, Rat No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH1 (195-226aa QKALKIMQQMSDHRYDKLTVPDDIAANCIYLN), different from the related mouse and rat sequences by one amino acid. |
|---|
| Other Names | N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 isoform 2; N(G),N(G)-dimethylarginine dimethylaminohydrolase 1; N(G),N(G)-dimethylarginine dimethylaminohydrolase 1; dimethylarginine dimethylaminohydrolase 1; DDAHI; Dimethylargininase-1, DDAH1; DDAH1; DDAH; HEL-S-16; DDAH; DDAH-1; Dimethylarginine dimethylaminohydrolase 1 |
|---|
| Gene, Accession # | DDAH1, Gene ID: 23576, NCBI: NP_001127917.1, UniProt: O94760 |
|---|
| Catalog # | MBS178500 |
|---|
| Price | |
|---|
| Order / More Info | DDAH1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Dayoub, H., Achan, V., Adimoolam, S., Jacobi, J., Stuehlinger, M. C., Wang, B., Tsao, P. S., Kimoto, M., Vallance, P., Patterson, A. J., Cooke, J. P. Dimethylarginine dimethylaminohydrolase regulates nitric oxide synthesis: genetic and physiological evidence.Circulation 108: 3042-3047, 2003. 2. Millatt, L. J., Whitley, G. StJ., Li, D., Leiper, J. M., Siragy, H. M., Carey, R. M., Johns, R. A. Evidence for dysregulation of dimethylarginine dimethylaminohydrolase I in chronic hypoxia-induced |
|---|
| 产品资料 |
|
|