| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DDAH2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-DDAH2 Antibody. Reactivity: Human, Mouse, Rat No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH2 (190-224aa DAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR), different from the related mouse and rat sequences by three amino acids. |
|---|
| Other Names | N(G),N(G)-dimethylarginine dimethylaminohydrolase 2; N(G),N(G)-dimethylarginine dimethylaminohydrolase 2; N(G),N(G)-dimethylarginine dimethylaminohydrolase 2; dimethylarginine dimethylaminohydrolase 2; DDAHII; Dimethylargininase-2; Protein G6a; S-phase protein, DDAH2; DDAH2; G6a; DDAH; NG30; DDAHII; HEL-S-277; DDAH; G6A; NG30; DDAH-2; Dimethylarginine dimethylaminohydrolase 2 |
|---|
| Gene, Accession # | DDAH2, Gene ID: 23564, NCBI: NP_001289936.1, UniProt: O95865 |
|---|
| Catalog # | MBS178501 |
|---|
| Price | |
|---|
| Order / More Info | DDAH2 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Leiper, J. M,, Santa Maria, J., Chubb, A., MacAllister, R. J., Charles, I. G., Whitley, G. S., Vallance, P. Identification of two human dimethylarginine dimethylaminohydrolases with distinct tissue distributions and homology with microbial arginine deiminases.Biochem. J. 343: 209-214, 1999. 2. Smith, C. L., Birdsey, G. M., Anthony, S., Arrigoni, F. I., Leiper, J. M., Vallance, P. Dimethylarginine dimethylaminohydrolase activity modulates ADMA levels, VEGF expression, and cell phenotype. B |
|---|
| 产品资料 |
|
|