| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SHIP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | n/a |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry (IHC), Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-SHIP Picoband Antibody. Reactivity: Human, Mouse, Rat No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence of human SHIP (NEDDKFTVQASEGVSMRFFTKLDQLIEFYKKENMGLVTHLQ).Subcellular Localization: Cytoplasm.Tissue Specificity: Specifically expressed in immune and hematopoietic cells. Expressed in bone marrow and blood cells. Levels vary considerably within this |
|---|
| Other Names | phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 isoform a; Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1; phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1; inositol polyphosphate-5-phosphatase D; Inositol polyphosphate-5-phosphatase of 145 kDa; SIP-145; SH2 domain-containing inositol 5'-phosphatase 1; SH2 domain-containing inositol phosphatase 1; SHIP-1; p150Ship; hp51CN, INPP5D; INPP5D; SHIP; SHIP1; SHIP-1; hp51CN; SIP-145; p150Ship; SHIP; SHIP1; SIP-145; SH2 domain- |
|---|
| Gene, Accession # | SHIP, Gene ID: 3635, NCBI: NP_001017915.1, UniProt: Q92835 |
|---|
| Catalog # | MBS1750829 |
|---|
| Price | |
|---|
| Order / More Info | SHIP Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|