| 产品详情 |
| Edit |   |
|---|
| Product Name | CBX2, Recombinant, Human, aa2-90, GST-tag |
|---|
| Description | Purified (~79%). Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A Lys119, rendering chromatin heritably changed in its expressibility. Involved in sexual development, acting as activator of NR5A1 expression. Source: Recombinant protein corresponding to aa2-90 from human chromobox homolog 2, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~37.3kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSEELSS VGEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKEH EKEVQNRKRGKRPRGRPRKLTAMSSCS Application |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | n/a |
|---|
| Other Names | CBX2, Recombinant, Human, aa2-90, GST-tag (Chromobox Homolog 2, SRXY5, Cell Division Cycle Associated 6, CDCA6) |
|---|
| Gene, Accession, CAS # | Accession: NM_005189, SwissProt: Q14781 |
|---|
| Catalog # | 298386 |
|---|
| Price | |
|---|
| Order / More Info | CBX2, Recombinant, Human, aa2-90, GST-tag from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|