| 产品详情 |
| Edit |   |
|---|
| Product Name | AGR2, Recombinant, Human, His-Tag |
|---|
| Description | Purity ~95% (SDS-PAGE). AGR2 (Anterior gradient 2 homolog) is the human orthologue of the secreted Xenopus laevis Anterior Gradient protein (XAG-2). This is a small, possibly secreted molecule of yet weakly defined functions that is widely expressed in human tissues. Expression of AGR2 shows a positive correlation with expression of estrogen receptor in breast carcinoma and a negative correlation with expression of EGF receptor. Recombinant human AGR2, fused to His-tag at N-terminal domain, was expressed in E.coli and purified by using conventional chromatography techniques. Source: Recombinant protein corresponding to aa21-175 from human AGR2, fused to His-tag at N-terminal domain, expressed in E.coli. Molecular Weight: ~22kD (MALDI-TOF) Endotoxin: ~1EU/ug (LAL) AA Sequence: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMRDTTVKPGAKKDTKDSRPKLPQTLSRWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKT EL |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | n/a |
|---|
| Other Names | AGR2, Recombinant, Human, His-Tag (Anterior Gradient Protein 2 Homolog, Secreted Cement Gland Protein XAG-2 Homolog, AG-2, hAG-2, HPC8, AG2, Anterior Gradient 2, UNQ515/PRO1030) |
|---|
| Gene, Accession, CAS # | n/a |
|---|
| Catalog # | 137529 |
|---|
| Price | |
|---|
| Order / More Info | AGR2, Recombinant, Human, His-Tag from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|